Iright
BRAND / VENDOR: Proteintech

Proteintech, 15941-1-AP, TMEM50B Polyclonal antibody

CATALOG NUMBER: 15941-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TMEM50B (15941-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM50B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15941-1-AP targets TMEM50B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, mouse heart tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:300-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TMEM50B, originally referred to as C21orf4, is a predicted transmembrane protein, estimated to contain four transmembrane-spanning domains with both the carboxy- and amino-terminals being cytoplasmic (PMID: 10077530; 18541381). Human TMEM50B shares sequence homologies of around 90-100% with mouse and rat Tmem50b. In a Down syndrome mouse model, Ts1Cje, Tmem50b is shown to be one of the few genes significantly over-expressed during cerebellar development (PMID: 15590701). It has been reported that rodent Tmem50b is a developmentally-regulated intracellular ER and Golgi apparatus membrane protein that may prove important for correct brain development through functions associated with precursor cells and glia (PMID: 18541381). TMEM50B can exist as a dimer and a trimer conformation (PMID: 18541381). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8220 Product name: Recombinant human TMEM50B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-158 aa of BC000569 Sequence: MAGFLDNFRWPECECIDWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHTCGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGAYVTQNTDVYPGLAVFFQNALIFFSTLIYKFGRTEELWT Predict reactive species Full Name: transmembrane protein 50B Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 14 kDa, 30 kDa, 50 kDa GenBank Accession Number: BC000569 Gene Symbol: TMEM50B Gene ID (NCBI): 757 RRID: AB_2205161 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56557 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924