Iright
BRAND / VENDOR: Proteintech

Proteintech, 15946-1-AP, LYL1 Polyclonal antibody

CATALOG NUMBER: 15946-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LYL1 (15946-1-AP) by Proteintech is a Polyclonal antibody targeting LYL1 in IP, ELISA applications with reactivity to human samples 15946-1-AP targets LYL1 in IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: K-562 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Lymphoblastic leukemia1 (LYL1) is a proto-oncogenic transcription factor found upregulated in patients with T-cell acute lymphoblastic leukemia (T-cell ALL). LYL1 has an important role in hematopoietic stem cell biology, normal hematopoiesis and leukemia. It is expressed throughout the hematopoietic lineages with the exception of T-cells. LYL1 shows two bands in the WB detection, where the upper band is the phosphorylated form and the lower band is the non-phosphorylated form (PMID: 10023675, PMID: 20844761). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8528 Product name: Recombinant human LYL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-280 aa of BC002796 Sequence: MCPPQAQAEVGPTMTEKAEMVCAPSPAPAPPPKPASPGPPQVEEVGHRGGSSPPRLPPGVPVISLGHSRPPGVAMPTTELGTLRPPLLQLSTLGTAPPTLALHYHPHPFLNSVYIGPAGPFSIFPSSRLKRRPSHCELDLAEGHQPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTHPPDRKLSKNEVLRLAMKYIGFLVRLLRDQAAALAAGPTPPGPRKRPVHRVPDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR Predict reactive species Full Name: lymphoblastic leukemia derived sequence 1 Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC002796 Gene Symbol: LYL1 Gene ID (NCBI): 4066 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P12980 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924