Proteintech, 15954-1-AP, Glucagon Polyclonal antibody

Size: 20ul / 150ul The Glucagon (15954-1-AP) by Proteintech is a Polyclonal antibody targeting Glucagon in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 15954-1-AP targets Glucagon in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human pancreas tissue, human small intestine tissue, mouse small intestine tissue, rat pancreas tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse pancreas tissue, human pancreas tissue, rat pancreas tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:12800-1:51200 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information BackgroundGlucagon is a protein cleaved from a precursor protein encoded by the GCG gene. The distinct peptides formed from this precursor include Glucagon, Glucagon-Like Peptide 1 (GLP-1), Glucagon-Like Peptide 2 (GLP-2), and oxyntomodulin. Glucagon is essential in maintaining blood glucose homeostasis and therefore has a key role in Type 1 and Type 2 diabetes.What is the molecular weight of Glucagon?21 kDa. Glucagon is composed of 180 amino acids and is a ligand for a specific G-protein coupled receptor (GPCR).Where is it expressed?Glucagon is a hormone secreted by the pancreas, in the α cells of the islets of Langerhans (PMID: 18880761). GLP-1, GLP-2, and oxyntomodulin are secreted by gut endocrine cells of the GI tract and also by selected neurons in the brain. These secreted proteins are transported to the target organ in plasma.What is the function of glucagon?The regulation of blood glucose levels is controlled by a balance of the hormones INS and glucagon in a negative feedback loop. A drop in blood glucose, or hypoglycemia, stimulates the release of glucagon. This initiates a cascade of signals, ultimately causing the conversion of stored glycogen into free glucose in a process called glycogenolysis, which takes place in liver and muscle cells. Glucagon can also stimulate gluconeogenesis in the liver, the process of forming glucose from non-carbohydrate sources such as amino acids (PMID: 13477815).What diseases are associated with glucagon?Glucagon is key in homeostasis of blood glucose and maintaining the balance between hyperglycaemia and hypoglycemia. It is therefore important in the study of Type 1 and Type 2 diabetes mellitus, where dysfunction of the pancreatic cells leads to a deregulation of blood glucose levels (PMID: 19326096). In both forms of the disease, glucagon secretion is impaired, from too much being secreted during hyperglycaemia, to too little being released to normalize hypoglycemia (PMID: 18197838). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8677 Product name: Recombinant human Glucagon protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC005278 Sequence: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK Predict reactive species Full Name: glucagon Calculated Molecular Weight: 180 aa, 21 kDa GenBank Accession Number: BC005278 Gene Symbol: Glucagon Gene ID (NCBI): 2641 RRID: AB_2878200 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01275 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.