Iright
BRAND / VENDOR: Proteintech

Proteintech, 15969-1-AP, SDCCAG3 Polyclonal antibody

CATALOG NUMBER: 15969-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SDCCAG3 (15969-1-AP) by Proteintech is a Polyclonal antibody targeting SDCCAG3 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 15969-1-AP targets SDCCAG3 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse testis tissue, rat testis tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information SDCCAG3, also named as NY-CO-3, is identified as serologically defined colon cancer antigen-3. It is an endosomal protein which is involved in the regulation of cytokinesis. SDCCAG3 is involved in modulation of TNF response. This gene has four isoforms with MW 40-50 kDa. Observed MW this protein is 48-60 kDa may due to phosphorylation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8745 Product name: Recombinant human SDCCAG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-412 aa of BC014515 Sequence: LGLDHNSPPSQTGGYGLEYQQPFFEDPTGAGDLLDGEEDEDTGWSGAYLPSAIEQTHPERVPAGTSPCSTYLSFFSTPSELAGPESLPSWALSDTDSRVSPASPAGSPSADFAVHGESLGDRHLRTLQISYDALKDENSKLRRKLNEVQSFSEAQTEMVRTLERKLEAKMIKEESDYHDLESVVQQVEQNLELMTKRAVKAENHVVKLKQEISLLQAQVSNFQRENEALRCGQGASLTVVKQNADVALQNLRVVMNSAQASIKQLVSGAETLNLVAEILKSIDRISEIKDEEEDS Predict reactive species Full Name: serologically defined colon cancer antigen 3 Calculated Molecular Weight: 412 aa, 46 kDa Observed Molecular Weight: 48-60 kDa GenBank Accession Number: BC014515 Gene Symbol: SDCCAG3 Gene ID (NCBI): 10807 RRID: AB_2183415 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96C92 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924