Iright
BRAND / VENDOR: Proteintech

Proteintech, 15974-1-AP, ERH Polyclonal antibody

CATALOG NUMBER: 15974-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ERH (15974-1-AP) by Proteintech is a Polyclonal antibody targeting ERH in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15974-1-AP targets ERH in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse testis tissue, rat liver tissue, rat testis tissue Positive IHC detected in: mouse testis tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8761 Product name: Recombinant human ERH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC014301 Sequence: MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK Predict reactive species Full Name: enhancer of rudimentary homolog (Drosophila) Calculated Molecular Weight: 104 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC014301 Gene Symbol: ERH Gene ID (NCBI): 2079 RRID: AB_2098556 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P84090 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924