Iright
BRAND / VENDOR: Proteintech

Proteintech, 15975-1-AP, TELO2 Polyclonal antibody

CATALOG NUMBER: 15975-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TELO2 (15975-1-AP) by Proteintech is a Polyclonal antibody targeting TELO2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 15975-1-AP targets TELO2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, Y79 cells Positive IP detected in: A431 cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information TELO2 gene encodes a telomere length regulation protein TEL2 homolog. TELO2 may be involved in telomere length regulation and can form TTT complex with TTI1 and TTI2. TTT complex is required to stabilize protein levels of PIKK family proteins and is involved in the cellular resistance to DNA damage stresses, like ionizing radiation (IR), ultraviolet (UV) and MMC. The activity of mTORC1 and mTORC2 complexes, which regulate cell growth and survival in response to nutrient and hormonal signals, can be promoted, stabilized and maintained by TELO2. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8763 Product name: Recombinant human TELO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 488-837 aa of BC017188 Sequence: DLDSDDEFVPYDMSGDRELKSSKAPAYVRDCVEALTTSEDIERWEAALRALEGLVYRSPTATREVSVELAKVLLHLEEKTCVVGFAGLRQRALVAVTVTDPAPVADYLTSQFYALNYSLRQRMDILDVLTLAAQELSRPGCLGRTPQPGSPSPNTPCLPEAAVSQPGSAVASDWRVVVEERIRSKTQRLSKGGPRQGPAGSPSRFNSVAGHFFFPLLQRFDRPLVTFDLLGEDQLVLGRLAHTLGALMCLAVNTTVAVAMGKALLEFVWALRFHIDAYVRQGLLSAVSSVLLSLPAARLLEDLMDELLEARSWLADVAEKDPDEDCRTLALRALLLLQRLKNRLLPPASP Predict reactive species Full Name: TEL2, telomere maintenance 2, homolog (S. cerevisiae) Calculated Molecular Weight: 837 aa, 92 kDa Observed Molecular Weight: 92 kDa GenBank Accession Number: BC017188 Gene Symbol: TELO2 Gene ID (NCBI): 9894 RRID: AB_2203337 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y4R8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924