Iright
BRAND / VENDOR: Proteintech

Proteintech, 15981-1-AP, ISG15 Polyclonal antibody

CATALOG NUMBER: 15981-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ISG15 (15981-1-AP) by Proteintech is a Polyclonal antibody targeting ISG15 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse samples 15981-1-AP targets ISG15 in WB, IHC, IF/ICC, IF-P, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, human brain tissue, A549 cells, MCF-7 cells, PC-3 cells, IFN alpha treated A459 cells, HepG2 cells, IFN alpha treated HepG2 cells Positive IHC detected in: human lung cancer tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ISG15 is a ubiquitin-like protein that becomes conjugated to many cellular proteins upon activation by interferon-alpha (IFNA) and -beta (IFNB). ISG15 forms covalent conjugates with its target proteins in a process called ISGylation, which in mammals is known to play a role in antiviral immunity. ISG15 proteins possess two ubiquitin-like (UBL) domains and a highly conserved C-terminal LRGG sequence, the latter being known as the ubiquitin conjugation motif. Intracellular ISG15 are conjugated, via the LRGG motif, to target proteins through a process called ISGylation, which resembles largely ubiquitination, the process of formation of ubiquitin conjugates. Unconjugated extracellular ISG15, which are released from several types of human and murine cells, are known to possess cytokine-like activity. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, pig, monkey, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8782 Product name: Recombinant human ISG15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC009507 Sequence: MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS Predict reactive species Full Name: ISG15 ubiquitin-like modifier Calculated Molecular Weight: 165 aa, 18 kDa Observed Molecular Weight: 15-17 kDa GenBank Accession Number: BC009507 Gene Symbol: ISG15 Gene ID (NCBI): 9636 RRID: AB_2126302 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05161 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924