Iright
BRAND / VENDOR: Proteintech

Proteintech, 16000-1-AP, FGL1 Polyclonal antibody

CATALOG NUMBER: 16000-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FGL1 (16000-1-AP) by Proteintech is a Polyclonal antibody targeting FGL1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 16000-1-AP targets FGL1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human placenta tissue, human liver tissue, HepG2 cells, mouse thymus tissue Positive IP detected in: HeLa cells Positive IHC detected in: human liver cancer tissue, human hepatocirrhosis tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FGL1 is a 68 kDa protein that comprises two disulfide linked 34 kDa homodimers. FGL1 is a predominantly liver expressed protein that has been implicated as both a hepatoprotectant and a hepatocyte mitogen. FGL1 expression is decreased in hepatocellular carcinoma (HCC), and it may play a role in the development of hepatocellular carcinomas. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8581 Product name: Recombinant human FGL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-312 aa of BC007047 Sequence: MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI Predict reactive species Full Name: fibrinogen-like 1 Calculated Molecular Weight: 312 aa, 36 kDa Observed Molecular Weight: 34 kDa, 68 kDa GenBank Accession Number: BC007047 Gene Symbol: FGL1 Gene ID (NCBI): 2267 RRID: AB_2103936 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q08830 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924