Iright
BRAND / VENDOR: Proteintech

Proteintech, 16009-1-AP, PLA2G12A Polyclonal antibody

CATALOG NUMBER: 16009-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PLA2G12A (16009-1-AP) by Proteintech is a Polyclonal antibody targeting PLA2G12A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16009-1-AP targets PLA2G12A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, HEK-293 cells, mouse heart tissue, mouse kidney tissue Positive IHC detected in: human colon cancer tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information PLA2G12A (or PLA2G12) gene encodes group XII secreted phospholipase A2 (sPLA2) which catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Cellular arachidonate (AA) release and prostaglandin (PG) production is regulated by sPLA(2)s, groups III and XII. Group XII sPLA2 have relatively low specific activity and are structurally and functionally distinct from other sPLA2s. Cells transfected with group XII sPLA(2) exhibited abnormal morphology, suggesting a unique functional aspect of this enzyme. Role of sPLA2s as potential tumour biomarkers and therapeutic targets for various cancers have been reported. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8722 Product name: Recombinant human PLA2G12A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-189 aa of BC017218 Sequence: QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL Predict reactive species Full Name: phospholipase A2, group XIIA Calculated Molecular Weight: 189 aa, 21 kDa Observed Molecular Weight: 21-24 kDa GenBank Accession Number: BC017218 Gene Symbol: PLA2G12A Gene ID (NCBI): 81579 RRID: AB_2164314 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BZM1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924