Iright
BRAND / VENDOR: Proteintech

Proteintech, 16015-1-AP, MMS19 Polyclonal antibody

CATALOG NUMBER: 16015-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MMS19 (16015-1-AP) by Proteintech is a Polyclonal antibody targeting MMS19 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16015-1-AP targets MMS19 in WB, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, human brain tissue, PC-3 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MMS19 plays a critical role in the biogenesis of multiple Fe-S proteins, which functions in genomic stability, RNA polymerase II function, and telomere length regulation. MMS19 has a alanine- and leucine-rich N terminus. It possible has a role in nucleotide excision repair(NER) and RNA polymerase II(POL II) transcription by interacting with ERCC2/XPB helicases, both subunits of NER-transcription factor TFIIH. Also MMS19 involves in the regulation of ER. It can function in chromosome segregation by acting as a part of the mitotic spindle-associated MMXD complex. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8792 Product name: Recombinant human MMS19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 457-803 aa of BC006575 Sequence: FLDGNVSFLPENSFPSRFQPFQDGSSGQRRLIALLMAFVCSLPRNVEIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPAGQQLDEFLQLAVDKVEAGLDSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAAADGFSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPQDVKPNYLKGLSHVLNRLPKPVLLPELPTLLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAALQCMHALTRLPTPVLLPYKPQVIRALAKPLDDKKRLVRKEAVSARGEWFLLGSPGS Predict reactive species Full Name: MMS19 nucleotide excision repair homolog (S. cerevisiae) Calculated Molecular Weight: 1030 aa, 113 kDa Observed Molecular Weight: 103-113 kDa GenBank Accession Number: BC006575 Gene Symbol: MMS19 Gene ID (NCBI): 64210 RRID: AB_2145043 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96T76 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924