Proteintech, 16018-1-AP, NAP1L4 Polyclonal antibody

Size: 20ul / 150ul The NAP1L4 (16018-1-AP) by Proteintech is a Polyclonal antibody targeting NAP1L4 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 16018-1-AP targets NAP1L4 in WB, IHC, IF, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse liver tissue, mouse testis tissue, HEK-293 cells, A431 cells Positive IP detected in: HeLa cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8827 Product name: Recombinant human NAP1L4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-375 aa of BC022090 Sequence: MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINALKQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESEWHSENEEEEKLAGDMKSKVVVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKVKFSDPGQPMSFVLEFHFEPNDYFTNSVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFNPLKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGEEGEEEELEGDEEGEDEDDAEINPKV Predict reactive species Full Name: nucleosome assembly protein 1-like 4 Calculated Molecular Weight: 375 aa, 43 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC022090 Gene Symbol: NAP1L4 Gene ID (NCBI): 4676 RRID: AB_2150711 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99733 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.