Proteintech, 16047-1-AP, Histone H4 Polyclonal antibody

Size: 20ul / 150ul The Histone H4 (16047-1-AP) by Proteintech is a Polyclonal antibody targeting Histone H4 in WB, IHC, IF/ICC, FC (Intra), IP, ChIP, ELISA applications with reactivity to human, mouse, rat samples 16047-1-AP targets Histone H4 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, HT-1080 cells, MCF-7 cells, mouse kidney tissue, mouse thymus tissue, rat thymus tissue Positive IP detected in: HeLa cells Positive IHC detected in: mouse small intestine tissue, mouse colon tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Positive ChIP detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Chromatin immunoprecipitation (ChIP): CHIP : Background Information Histone H4 is a 103 amino acid protein, which belongs to the histone H4 family. Histone H4 localizes in the nucleus and is a core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, bovine, yeast Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8999 Product name: Recombinant human Histone H4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC012587 Sequence: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG Predict reactive species Full Name: histone cluster 1, H4e Calculated Molecular Weight: 102 aa, 11 kDa Observed Molecular Weight: 14 kDa, 11 kDa GenBank Accession Number: BC012587 Gene Symbol: Histone H4 Gene ID (NCBI): 8367 RRID: AB_2118625 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62805 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.