Proteintech, 16054-1-AP, ATP6V1C1 Polyclonal antibody

Size: 20ul / 150ul The ATP6V1C1 (16054-1-AP) by Proteintech is a Polyclonal antibody targeting ATP6V1C1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16054-1-AP targets ATP6V1C1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, NIH/3T3 cells, human brain tissue, human testis tissue, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information The vacuolar H+-ATPase (V-ATPase) is a functionally conserved multimeric complex localized at the membranes of many organelles where its proton-pumping action is required for proper lumen acidification (PMID: 39210597). ATP6V1C1, also known as ATPase, H+ transporting, lysosomal V1 subunit C1, is a component of the V1 sector of the V-ATPase complex. ATP6v1c1 knockdown significantly reduces tumor stimulated bone resorption through osteoclastogenesis at the bone and metastasis in vivo, as well as V-ATPase activity, proliferation, and mTORC1 activation in vitro (PMID: 28504970). Also, ATP6V1C1, associated with the tumor microenvironment and mTORC1 signaling pathway, is a potential diagnostic, prognostic, and therapeutic biomarker for hepatocellular carcinoma () (PMID: 39557733). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9020 Product name: Recombinant human ATP6V1C1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-381 aa of BC010960 Sequence: MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEF Predict reactive species Full Name: ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 Calculated Molecular Weight: 382 aa, 44 kDa Observed Molecular Weight: 42-44 kDa GenBank Accession Number: BC010960 Gene Symbol: ATP6V1C1 Gene ID (NCBI): 528 RRID: AB_2062501 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21283 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.