Iright
BRAND / VENDOR: Proteintech

Proteintech, 16056-1-AP, SAP30L Polyclonal antibody

CATALOG NUMBER: 16056-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SAP30L (16056-1-AP) by Proteintech is a Polyclonal antibody targeting SAP30L in WB, ELISA applications with reactivity to human, mouse, rat samples 16056-1-AP targets SAP30L in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human peripheral blood platelets, mouse lung tissue, rat lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information SAP30L, also named as NS4ATP2, is one of the key proteins in a multi‐subunit protein complex involved in transcriptional regulation via histone deacetylation. SAP30L is an essential component of the Sin3A corepressor complex. The MW migrates to 26-30 kDa with phospho and SUMO modification and may generate complexes. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9024 Product name: Recombinant human SAP30L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC009829 Sequence: MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIEDGERCVRPAGNASFSKRVQKSISQKKLKLDIDKSVRHLYICDFHKNFIQSVRNKRKRKTSDDGGDSPEHDTDIPEVDLFQLQVNTLRRYKRHYKLQTRPGFNKAQLAETVSRHFRNIPVNEKETLAYFIYMVKSNKSRLDQKSEGGKQLE Predict reactive species Full Name: SAP30-like Calculated Molecular Weight: 183 aa, 21 kDa Observed Molecular Weight: 21-25 kDa GenBank Accession Number: BC009829 Gene Symbol: SAP30L Gene ID (NCBI): 79685 RRID: AB_3085479 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HAJ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924