Proteintech, 16061-1-AP, GINS1 Polyclonal antibody

Size: 20ul / 150ul The GINS1 (16061-1-AP) by Proteintech is a Polyclonal antibody targeting GINS1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16061-1-AP targets GINS1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, mouse testis tissue, SH-SY5Y cells, U-251 cells, mouse thymus tissue, rat testis tissue, rat thymus tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GINS1, also known as Partner of SLD Five 1 (PSF1) is a member of the GINS (Go-Ichi-Nii-San) complex, which plays a vital role in the initiation and elongation of DNA replication (PMID: 34414190). GINS1 was initially found to be predominantly expressed in highly proliferating cells instead of mature cells. Later on, it was found that GINS was involved in the tumorigenesis of various cancers, including breast cancer, colorectal cancer, and hepatocellular carcinoma (PMID: 36065190). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8895 Product name: Recombinant human GINS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-196 aa of BC012542 Sequence: MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS Predict reactive species Full Name: GINS complex subunit 1 (Psf1 homolog) Calculated Molecular Weight: 196 aa, 23 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC012542 Gene Symbol: GINS1 Gene ID (NCBI): 9837 RRID: AB_3669229 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14691 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.