Proteintech, 16084-1-AP, NUP160 Polyclonal antibody

Size: 20ul / 150ul The NUP160 (16084-1-AP) by Proteintech is a Polyclonal antibody targeting NUP160 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 16084-1-AP targets NUP160 in WB, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human brain tissue Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9083 Product name: Recombinant human NUP160 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-190 aa of BC009822 Sequence: MAAAGALERSFVELSGAERERPRHFREFTVCSIGTANAVAGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELMEESLDINLLNNAIRLKFQNCSVLPGGVYVSETQNRVIILMLTNQTVHRLLLPHPSRMYRSVSWLSAISFISQITLGVTNVVLERCLLELKEIWILVIPHQAYFDSYRLK Predict reactive species Full Name: nucleoporin 160kDa Calculated Molecular Weight: 1316 aa, 149 kDa Observed Molecular Weight: 149 kDa GenBank Accession Number: BC009822 Gene Symbol: NUP160 Gene ID (NCBI): 23279 RRID: AB_2157341 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12769 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.