Iright
BRAND / VENDOR: Proteintech

Proteintech, 16094-1-AP, KPTN Polyclonal antibody

CATALOG NUMBER: 16094-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The KPTN (16094-1-AP) by Proteintech is a Polyclonal antibody targeting KPTN in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16094-1-AP targets KPTN in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, NIH/3T3 cells, human cerebellum tissue, mouse skeletal muscle tissue Positive IHC detected in: human kidney tissue, human heart tissue, human lung tissue, human ovary tissue, human placenta tissue, human skin tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information Kaptin, also named as KPTN and Actin-associated protein 2E4, originally isolated from human blood platelets and likely to be involved in the actin rearrangements occurring during activation. It plays a unique role in the actin rearrangements that accompany platelet activation and stereocilia formation. Kaptin is necessary for normal neuromorphogenesis. It may play a role in producing the sensory apparatus in hair cells. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8785 Product name: Recombinant human KPTN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 79-436 aa of BC009249 Sequence: EIVSIDTFNKSPPKRGLVVGITFIKDSGDKGSPFLNIYCDYEPGSEYNLDSIAQSCLNLELQFTPFQLCHAEVQVGDQLETVFLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVLQDGPISRVIVFSLSAAKETKDRPLQDEYSVLVASMLEPAVVYRDLLNRGLEDQLLLPGSDQFDSVLCSLVTDVDLDGRPEVLVATYGQELLCYKYRGPESGLPEAQHGFHLLWQRSFSSPLLAMAHVDLTGDGLQELAVVSLKGVHILQHSLIQASELVLTRLRHQVEQRRRRLQGLEDGAGAGPAENAAS Predict reactive species Full Name: kaptin (actin binding protein) Calculated Molecular Weight: 436 aa, 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC009249 Gene Symbol: KPTN Gene ID (NCBI): 11133 RRID: AB_2134007 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y664 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924