Iright
BRAND / VENDOR: Proteintech

Proteintech, 16097-1-AP, PELI2 Polyclonal antibody

CATALOG NUMBER: 16097-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PELI2 (16097-1-AP) by Proteintech is a Polyclonal antibody targeting PELI2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16097-1-AP targets PELI2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Pellino2 (PELI2) is a newly discovered E3 ubiquitin ligase, which regulates the protein degradation, protein-protein interaction, protein translocation and signaling transduction via the ubiquitination of target proteins, and plays important roles in inflammation and the immune system. PELI2 possesses a C-terminal RING-like domain and a phospho-threonine-binding forkhead-associated (FHA) domain that are responsible for ubiquitin ligase activity and substrate binding, respectively (PMID: 24699078).IHC Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8940 Product name: Recombinant human PELI2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-420 aa of BC009476 Sequence: RPQCPVGLNTLAFPSINRKEVVEEKQPWAYLSCGHVHGYHNWGHRSDTEANERECPMCRTVGPYVPLWLGCEAGFYVDAGPPTHAFTPCGHVCSEKSAKYWSQIPLPHGTHAFHAACPFCATQLVGEQNCIKLIFQGPID Predict reactive species Full Name: pellino homolog 2 (Drosophila) Calculated Molecular Weight: 420 aa, 46 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC009476 Gene Symbol: PELI2 Gene ID (NCBI): 57161 RRID: AB_2878218 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HAT8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924