Proteintech, 16110-1-AP, PBK/SPK Polyclonal antibody

Size: 20ul / 150ul The PBK/SPK (16110-1-AP) by Proteintech is a Polyclonal antibody targeting PBK/SPK in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 16110-1-AP targets PBK/SPK in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, mouse ovary tissue, mouse testis tissue, NIH/3T3 cells, rat testis tissue Positive IHC detected in: human placenta tissue, human lung cancer tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:3000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information PBK(PDZ-binding kinase) is also named as TOPK, CT84, Nori-3, SPK and belongs to the MAP kinase kinase subfamily. PBK may have a role in the regulation of cellular proliferation and progression of the cell cycle. It has a characteristic cdc2ycyclin B phosphorylation site(SyT-P-X-KyR) at its N terminus,which is conserved across species, and it is phosphorylated in a cell cycle-dependent manner at mitosis, and that this phosphorylation is required for its activation(PMID:10779557). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9033 Product name: Recombinant human SPK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-322 aa of BC015191 Sequence: MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV Predict reactive species Full Name: PDZ binding kinase Calculated Molecular Weight: 322 aa, 36 kDa Observed Molecular Weight: 36-40 kDa GenBank Accession Number: BC015191 Gene Symbol: PBK Gene ID (NCBI): 55872 RRID: AB_2283508 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96KB5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.