Iright
BRAND / VENDOR: Proteintech

Proteintech, 16117-1-AP, RAC1/2/3 Polyclonal antibody

CATALOG NUMBER: 16117-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RAC1/2/3 (16117-1-AP) by Proteintech is a Polyclonal antibody targeting RAC1/2/3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 16117-1-AP targets RAC1/2/3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, human brain tissue, mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Rac3 is a GTPase that belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. There are three Rac genes in mammals, which share over 90% protein identity but differ for their pattern of expression. Rac1 is ubiquitous, Rac2 is specific for hematopoietic cells, while Rac3 is prevalent in the developing nervous system. This antibody can recognize Rac1, Rac2, and Rac3. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9045 Product name: Recombinant human RAC1/2/3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC015197 Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF Predict reactive species Full Name: ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) Calculated Molecular Weight: 192 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC015197 Gene Symbol: RAC3 Gene ID (NCBI): 5881 RRID: AB_2176154 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P60763 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924