Proteintech, 16121-1-AP, RLIM Polyclonal antibody

Size: 20ul / 150ul The RLIM (16121-1-AP) by Proteintech is a Polyclonal antibody targeting RLIM in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 16121-1-AP targets RLIM in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information RLIM (RING finger LIM domain-binding protein), also known as RNF12 (RING finger protein 12) or NY-REN-43, is a 624 amino acid RING-H2 zinc finger protein that is involved in protein ubiquitinylation and subsequent degradation. Expressed in a variety of tissues, RLIM binds to the LIM domain of various proteins and functions as a protein ligase that negatively co-regulates LIM homeodomain (LIM-HD) transcription factors. Through its interaction with Sin3A, a component of the histone deacetylase corepressor complex, RLIM is able to recruit the corepressor complex to LIM-HD proteins, thereby inhibiting LIM-HD transcription. In addition to recruiting the deacetylase complex to LIM-HD proteins, RLIM is able to bind to, ubiquinate and subsequently degrade CLIM proteins, which function as positive co-regulators of LIM-HD transcription factors. RLIM contains one RING-type zinc finger and is implicated in renal cell carcinoma. The calcualted molecular weight of RLIM is 69 kDa, but modified RLIM is about 70-75 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9077 Product name: Recombinant human RLIM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 276-350 aa of BC013357 Sequence: SGPELLSRGLFAASGTRNASQGAGSSDTAASGESTGSGQRPPTIVLDLQVRRVRPGEYRQRDSIASRTRSRSQTP Predict reactive species Full Name: ring finger protein, LIM domain interacting Calculated Molecular Weight: 624 aa, 69 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC013357 Gene Symbol: RLIM Gene ID (NCBI): 51132 RRID: AB_2181967 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NVW2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.