Iright
BRAND / VENDOR: Proteintech

Proteintech, 16127-1-AP, CLMP Polyclonal antibody

CATALOG NUMBER: 16127-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CLMP (16127-1-AP) by Proteintech is a Polyclonal antibody targeting CLMP in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16127-1-AP targets CLMP in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, 3T3-L1 cells, rat brain tissue Positive IHC detected in: mouse brown adipose tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information CLMP (Coxsackie- and adenovirus receptor-like membrane protein), also known as ACAM (adipocyte adhesion molecule) or ASAM, is a member of the CTX (cortical thymocyte marker in Xenopus) family of proteins. CTX family proteins are type I transmembrane proteins within the Ig superfamily that localize to junctional complexes between endothelial and epithelial cells and may play a role in cell-cell adhesion. CLMP is predominantly expressed in epithelial cells within different tissues and in the white adipose tissue. It may be involved in the cell-cell adhesion and may play a role in adipocyte differentiation and development of obesity. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9111 Product name: Recombinant human ASAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-229 aa of BC009371 Sequence: EIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTAGNEAGKESCVVRVTVQYVQ Predict reactive species Full Name: adipocyte-specific adhesion molecule Calculated Molecular Weight: 373 aa, 41 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC009371 Gene Symbol: CLMP Gene ID (NCBI): 79827 RRID: AB_2878221 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H6B4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924