Proteintech, 16139-1-AP, MRPS18B Polyclonal antibody

Size: 20ul / 150ul The MRPS18B (16139-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS18B in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 16139-1-AP targets MRPS18B in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, mouse liver tissue, rat heart tissue, HEK-293 cells, MCF-7 cells, PC-3 cells, SH-SY5Y cells Positive IP detected in: HeLa cells Positive IHC detected in: human breast cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information MRPS18B, also named as S18mt-b, MRP-S18-2 and C6orf14, belongs to the ribosomal protein S18P family. It is a component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins. This antibody recognizes specifically the 29 kd MRPS18B protein. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9198 Product name: Recombinant human MRPS18B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-258 aa of BC005373 Sequence: MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSSDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL Predict reactive species Full Name: mitochondrial ribosomal protein S18B Calculated Molecular Weight: 258 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC005373 Gene Symbol: MRPS18B Gene ID (NCBI): 28973 RRID: AB_2146368 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y676 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.