Proteintech, 16199-1-AP, HTF9C Polyclonal antibody

Size: 20ul / 150ul The HTF9C (16199-1-AP) by Proteintech is a Polyclonal antibody targeting HTF9C in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16199-1-AP targets HTF9C in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, HepG2 cells, mouse liver tissue Positive IHC detected in: human kidney tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information tRNA methyltransferase 2 homolog A (TRMT2A), also known as HTF9C is a novel cell cycle regulated protein, as associated with aggressive clinical course. HTF9C harbors a putative RNA recognition motif (RRM) in the N-terminus and the conserved uracil-C5-methyltransferase domain of the TrmA family in the C-terminus. HTF9C antibody can detect two bands about 68 kDa and 40 kDa (PMID: 20307320). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9112 Product name: Recombinant human TRMT2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 277-625 aa of BC013352 Sequence: DTVHIPEATKQVVKAFQEFIRSTPYSAYDPETYTGHWKQLTVRTSRRHQAMAIAYFHPQKLSPEELAELKTSLAQHFTAGPGRASGVTCLYFVEEGQRKTPSQEGLPLEHVAGDRCIHEDLLGLTFRISPHAFFQVNTPAAEVLYTVIQDWAQLDAGSMVLDVCCGTGTIGLALARKVKRVIGVELCPEAVEDARVNAQDNELSNVEFHCGRAEDLVPTLVSRLASQHLVAILDPPRAGLHSKVILAIRRAKNLRRLLYVSCNPRAAMGNFVDLCRAPSNRVKGIPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGPHSPPAQPTPGPPDNTLQETGTFPSS Predict reactive species Full Name: TRM2 tRNA methyltransferase 2 homolog A (S. cerevisiae) Calculated Molecular Weight: 625 aa, 69 kDa Observed Molecular Weight: 42-44 kDa, 68-75 kDa GenBank Accession Number: BC013352 Gene Symbol: TRMT2A Gene ID (NCBI): 27037 RRID: AB_2209623 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IZ69 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.