Iright
BRAND / VENDOR: Proteintech

Proteintech, 16209-1-AP, GGCX Polyclonal antibody

CATALOG NUMBER: 16209-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GGCX (16209-1-AP) by Proteintech is a Polyclonal antibody targeting GGCX in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 16209-1-AP targets GGCX in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF7 cells, HEK-293 cells, HepG2 cells, L02 cells, MCF-7 cells, mouse liver tissue, PC-3 cells Positive IP detected in: mouse liver tissue Positive IHC detected in: human liver tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information GGCX(Gamma-glutamyl carboxylase) is also named as GC and belongs to the vitamin K-dependent gamma-carboxylase family. This 94 kDa (including all modifications, such as the five N-linked glycosylations), is a 5-pass transmembrane protein and a key regulator of blood coagulation(PMID:20518534). It mediates the vitamin K-dependent carboxylation of glutamate residues to calcium-binding gamma-carboxyglutamate (Gla) residues with the concomitant conversion of the reduced hydroquinone form of vitamin K to vitamin K epoxide. Defects in GGCX are a cause of combined deficiency of vitamin K-dependent clotting factors type 1 (VKCFD1) and pseudoxanthoma elasticum-like disorder with multiple coagulation factor deficiency (PXEL-MCFD)(PMID:9845520;17110937). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9185 Product name: Recombinant human GGCX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 383-758 aa of BC013979 Sequence: LTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGRTGELGYLNPGVFTQSRRWKDHADMLKQYATCLSRLLPKYNVTEPQIYFDIWVSINDRFQQRIFDPRVDIVQAAWSPFQRTSWVQPLLMDLSPWRAKLQEIKSSLDNHTEVVFIADFPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVKGGPEPTPLVQTFLRRQQRLQEIERRRNTPFHERFFRFLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGELNPSNTDSSHSNPPESNPDPVHSEF Predict reactive species Full Name: gamma-glutamyl carboxylase Calculated Molecular Weight: 758 aa, 88 kDa Observed Molecular Weight: 88 kDa GenBank Accession Number: BC013979 Gene Symbol: GGCX Gene ID (NCBI): 2677 RRID: AB_2110874 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P38435 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924