Proteintech, 16238-1-AP, WRNIP1 Polyclonal antibody

Size: 20ul / 150ul The WRNIP1 (16238-1-AP) by Proteintech is a Polyclonal antibody targeting WRNIP1 in WB, ELISA applications with reactivity to human, mouse, rat samples 16238-1-AP targets WRNIP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human colon tissue, human kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Human WRN-interacting protein 1 (WRNIP1) is a genome maintenance factor. Functions as a modulator of initiation or reinitiation events during DNA polymerase delta-mediated DNA synthesis. In the presence of ATP, stimulation of DNA polymerase delta-mediated DNA synthesis is decreased. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9040 Product name: Recombinant human WRNIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 293-640 aa of BC018923 Sequence: VTLSATNAKTNDVRDVIKQAQNEKSFFKRKTILFIDEIHRFNKSQQVNAALLSRCRVIVLEKLPVEAMVTILMRAINSLGIHVLDSSRPTDPLSHSSNSSSEPAMFIEDKAVDTLAYLSDGDARAGLNGLQLAVLARLSSRKMFCKKSGQSYSPSRVLITENDVKEGLQRSHILYDRAGEEHYNCISALHKSMRGSDQNASLYWLARMLEGGEDPLYVARRLVRFASEDIGLADPSALTQAVAAYQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKACLRNHQGPLPPVPLHLRNAPTRLMKDLGYGKGYKYNPMYSEPVDQEYLPEELRGVDFFKQRRC Predict reactive species Full Name: Werner helicase interacting protein 1 Calculated Molecular Weight: 665aa,72 kDa; 640aa,69 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC018923 Gene Symbol: WRNIP1 Gene ID (NCBI): 56897 RRID: AB_2288535 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96S55 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.