Iright
BRAND / VENDOR: Proteintech

Proteintech, 16246-1-AP, SAT2 Polyclonal antibody

CATALOG NUMBER: 16246-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SAT2 (16246-1-AP) by Proteintech is a Polyclonal antibody targeting SAT2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16246-1-AP targets SAT2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat liver tissue Positive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Spermidine/spermine N1-acetyltransferase 2 (SAT2) is a short-lived polyamine catabolic enzyme inducible by polyamines and polyamine analogues. Human SAT2 contains the highly conserved acetyl-CoA-binding domain and displays coactivator function to enhance NF-κB-dependent transcription and enhances TNFα-induced NF-κB activity (PMID: 17875644). Human SAT1 and SAT2 proteins, which share 46% amino acid sequence identity and are clearly homologous, both interact with HIF-1α and both promote the ubiquitination and degradation of HIF-1α (PMID: 17011643). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9179 Product name: Recombinant human SAT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC011751 Sequence: MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAGK Predict reactive species Full Name: spermidine/spermine N1-acetyltransferase family member 2 Calculated Molecular Weight: 170 aa, 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC011751 Gene Symbol: SAT2 Gene ID (NCBI): 112483 RRID: AB_2254874 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96F10 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924