Iright
BRAND / VENDOR: Proteintech

Proteintech, 16258-1-AP, RGS14 Polyclonal antibody

CATALOG NUMBER: 16258-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RGS14 (16258-1-AP) by Proteintech is a Polyclonal antibody targeting RGS14 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 16258-1-AP targets RGS14 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, mouse testis tissue, mouse brain tissue, mouse spleen tissue, HepG2 cells, HuH-7 cells, mouse liver tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:2500-1:10000 Background Information RGS14, a member of the R12 subfamily of RGS proteins, is highly expressed in the brain and is a natural suppressor of CA2 hippocampal synaptic plasticity and learning and memory. RGS14 was first identified as a complex scaffolding protein with an unconventional domain structure that allows it to interact with various protein binding partners. RGS14 contains one RGS domain, two Raf-like Ras-binding domains (RBDs), and one GoLoco domain. The protein attenuates the signaling activity of G-proteins by binding, through its GoLoco domain, to specific types of activated, GTP-bound G alpha subunits. Acting as a GTPase activating protein (GAP), the protein increases the rate of conversion of the GTP to GDP. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9292 Product name: Recombinant human RGS14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 217-566 aa of BC014094 Sequence: KSLPLGVEELGQLPPVEGPGGRPLRKSFRRELGGTANAALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSTEGESESRPGKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQALVLDQDCTVLADQEVRLENRITFELELTALERVVRISAKPTKRLQEALQPILEKHGLSPLEVVLHRPGEKQPLDLGKLVSSVAAQRLVLDTLPGVKISKARDKSPCRSQGCPPRTQDKATHPPPASPSSLVKVPSSATGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPAQGPSSEETPPQTKSAAQPIGGSLNSTTDSAL Predict reactive species Full Name: regulator of G-protein signaling 14 Calculated Molecular Weight: 566 aa, 61 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: BC014094 Gene Symbol: RGS14 Gene ID (NCBI): 10636 RRID: AB_2179918 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43566 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924