Proteintech, 16262-1-AP, MED28 Polyclonal antibody

Size: 20ul / 150ul The MED28 (16262-1-AP) by Proteintech is a Polyclonal antibody targeting MED28 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16262-1-AP targets MED28 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, PC-12 cells, rat testis tissue Positive IHC detected in: mouse testis tissue, mouse brain tissue, human kidney tissue, human placenta tissue, human testis tissue, human brain tissue, human liver tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9327 Product name: Recombinant human MED28 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC011936 Sequence: MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT Predict reactive species Full Name: mediator complex subunit 28 Calculated Molecular Weight: 178 aa, 20 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC011936 Gene Symbol: MED28 Gene ID (NCBI): 80306 RRID: AB_2281863 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H204 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.