Proteintech, 16271-1-AP, GCC1 Polyclonal antibody

Size: 20ul / 150ul The GCC1 (16271-1-AP) by Proteintech is a Polyclonal antibody targeting GCC1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 16271-1-AP targets GCC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, mouse ovary tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information GCC1 (Golgi coiled coil protein 1), also known as GCC1P or GCC88, is a protein probably involved in maintaining Golgi structure. The MW of this protein is 105 kDa, and Catalog#16271-1-AP specially recognises the 105 kDa protein. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9339 Product name: Recombinant human GCC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 424-775 aa of BC014100 Sequence: ESSLDVNVLKDKMEKLKRLLQVAARKSQVTLDVEKLCDLEIMPSSEAADGEKATALYYQQELKQLKEEFERYKMRAQVVLKSKNTKDGNLGKELEAAQEQLAELKEKYISLRLSCEELEHQHQQEADDWKQELARLQQLHRQELERCQLDFRDRTLKLEEELHKQRDRALAVLTEKDLELEQLRSVALASGLPGRRSPVGGGGPGDPADTSSSDSLTQALQLAAANEPTFFLYAEQLARKEVEITSLRKQKHRLEVEVHQLQDRLLEEGERHREEVAALQSHIEKNIRDQSREGANLEYLKNIIYRFLTLPDSLGRQQTLTAILTILHFSPEEKQVIMRLPTSASWWPSGKR Predict reactive species Full Name: GRIP and coiled-coil domain containing 1 Calculated Molecular Weight: 775 aa, 88 kDa Observed Molecular Weight: 105 kDa GenBank Accession Number: BC014100 Gene Symbol: GCC1 Gene ID (NCBI): 79571 RRID: AB_2107197 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96CN9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.