Proteintech, 16285-1-AP, HN1L Polyclonal antibody

Size: 20ul / 150ul The HN1L (16285-1-AP) by Proteintech is a Polyclonal antibody targeting HN1L in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 16285-1-AP targets HN1L in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Hematological and neurological expressed 1-like protein (HN1L), also known as Jupiter microtubule-associated homolog 2 (JPT2), belongs to the jupiter family. HN1L is nicotinic acid adenine dinucleotide phosphate (NAADP) binding protein required for NAADP-evoked intracellular calcium release (PubMed:33758061). HN1L enables NAADP to activate Ca2+ release from the endoplasmic reticulum through ryanodine receptors (PubMed:33758062). HN1L was also required for the translocation of a severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) pseudovirus through the endolysosomal systemHN1L is expressed in liver, kidney, prostate, testis and uterus (PMID: 15094197). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9400 Product name: Recombinant human HN1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-190 aa of BC014438 Sequence: MFQVPDSEGGRAGSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSGIFDESTPVQTRQHLNPPGGKTSDIFGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY Predict reactive species Full Name: hematological and neurological expressed 1-like Calculated Molecular Weight: 190 aa, 20 kDa Observed Molecular Weight: 20-25 kDa GenBank Accession Number: BC014438 Gene Symbol: HN1L Gene ID (NCBI): 90861 RRID: AB_3085484 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H910 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.