Iright
BRAND / VENDOR: Proteintech

Proteintech, 16287-1-AP, MYL12A Polyclonal antibody

CATALOG NUMBER: 16287-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MYL12A (16287-1-AP) by Proteintech is a Polyclonal antibody targeting MYL12A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16287-1-AP targets MYL12A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, HeLa cells, Jurkat cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Background Information Myosin II is an actin-binding protein composed of MHC (myosin heavy chain), MLCs/MRLCs (myosin regulatory light chains) and ELCs (essential light chains). The Myosin Light Chains are divided into basic MLC (MLC I) and regulatory MLC (MLC II or Myosin Regulatory Light Chain, MRLC). MRLC can be classified into two major types: : class I MRLC found in muscles (MLC1, MLC2, MLC3, MYL4, MYL5, MYL6, MYL7, etc), and class II MRLCs present in non-muscle cells (such as MYL9, MYL12A, MYL12B). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig, frog Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9413 Product name: Recombinant human MYL12A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC016372 Sequence: MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD Predict reactive species Full Name: myosin, light chain 12A, regulatory, non-sarcomeric Calculated Molecular Weight: 171 aa, 20 kDa Observed Molecular Weight: 19-20 kDa GenBank Accession Number: BC016372 Gene Symbol: MYL12A Gene ID (NCBI): 10627 RRID: AB_2878238 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P19105 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924