Iright
BRAND / VENDOR: Proteintech

Proteintech, 16326-1-AP, Placental lactogen Polyclonal antibody

CATALOG NUMBER: 16326-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Placental lactogen (16326-1-AP) by Proteintech is a Polyclonal antibody targeting Placental lactogen in WB, IHC, IF-P, ELISA applications with reactivity to human samples 16326-1-AP targets Placental lactogen in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue, human colon tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information The human growth hormone (GH) locus is comprised by two GH (GH1 and GH2) genes and three chorionic somatomammotropin (CSH1, CSH2 and CSH-L) genes. Placental lactogens (CSH1, CSH2) are produced in the mammalian placenta and are similar in structure and function to growth hormones. Together, placental lactogens and growth factors play an essential role to assure successful lactation after pregnancy. Placental lactogens also modify the metabolic state of the mother during pregnancy to supply energy to the fetus. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9412 Product name: Recombinant human CSH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-217 aa of BC022044 Sequence: MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF Predict reactive species Full Name: chorionic somatomammotropin hormone 2 Calculated Molecular Weight: 217 aa, 25 kDa Observed Molecular Weight: 20-25 kDa GenBank Accession Number: BC022044 Gene Symbol: CSH2 Gene ID (NCBI): 1443 RRID: AB_2083883 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01243 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924