Iright
BRAND / VENDOR: Proteintech

Proteintech, 16332-1-AP, GUSB Polyclonal antibody

CATALOG NUMBER: 16332-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GUSB (16332-1-AP) by Proteintech is a Polyclonal antibody targeting GUSB in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16332-1-AP targets GUSB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, mouse liver tissue, HL-60 cells, mouse heart tissue, K-562 cells, rat liver tissue Positive IHC detected in: human colon cancer tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information The GUSB gene encodes beta-glucuronidase, a lysosomal hydrolase involved in the stepwise degradation of glucuronic acid-containing glycosaminoglycans. It is a tetrameric glycoprotein composed of identical subunits. GUSB plays an important role in the degradation of dermatan and keratan sulfates. GUSB has two isoforms with the molecular mass of 75 kDa and 69 kDa, and it always can be detected as 78 kDa, 60 kDa and 18 kDa. The 60 kDa and 18 kDa polypeptides are derived by nicking 78-kDa GUSB subunit at Val159-Gly160 (PMID: 1311180, 9268591). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9453 Product name: Recombinant human GUSB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 302-651 aa of BC014142 Sequence: SLEVQLTAQTSLGPVSDFYTLPVGIRTVAVTKSQFLINGKPFYFHGVNKHEDADIRGKGFDWPLLVKDFNLLRWLGANAFRTSHYPYAEEVMQMCDRYGIVVIDECPGVGLALPQFFNNVSLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYYLKMVIAHTKSLDPSRPVTFVSNSNYAADKGAPYVDVICLNSYYSWYHDYGHLELIQLQLATQFENWYKKYQKPIIQSEYGAETIAGFHQDPPLMFTEEYQKSLLEQYHLGLDQKRRKYVVGELIWNFADFMTEQSPTRVLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSLFT Predict reactive species Full Name: glucuronidase, beta Calculated Molecular Weight: 651 aa, 75 kDa Observed Molecular Weight: 78 kDa GenBank Accession Number: BC014142 Gene Symbol: GUSB Gene ID (NCBI): 2990 RRID: AB_2279538 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08236 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924