Proteintech, 16334-1-AP, GPR146 Polyclonal antibody

Size: 20ul / 150ul The GPR146 (16334-1-AP) by Proteintech is a Polyclonal antibody targeting GPR146 in IHC, ELISA applications with reactivity to human, mouse samples 16334-1-AP targets GPR146 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse liver tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information As a member of GPCRs, GPR146 (G protein-coupled receptor 146) was initially discovered as a c-peptide signal body. GPR146 may act as a c peptide receptor to interact with proinsulin c-peptide to regulate insulin levels (PMID: 37926274). Mechanically, GPR146 induces hepatic sterol regulatory element binding protein 2 (SREBP2) via the activation of extracellular signal-regulated kinase 1/2 (ERK1/2) signaling, consequently resulting in hepatic low-density lipoprotein (VLDL) secretion (PMID: 32491159). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9456 Product name: Recombinant human GPR146 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 211-333 aa of BC014241 Sequence: SRVRREDTPLDRDTGRLEPSAHRLLVATVCTQFGLWTPHYLILLGHTVIISRGKPVDAHYLGLLHFVKDFSKLLAFSSSFVTPLLYRYMNQSFPSKLQRLMKKLPCGDRHCSPDHMGVQQVLA Predict reactive species Full Name: G protein-coupled receptor 146 Calculated Molecular Weight: 333 aa, 37 kDa GenBank Accession Number: BC014241 Gene Symbol: GPR146 Gene ID (NCBI): 115330 RRID: AB_3669240 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96CH1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.