Proteintech, 16365-1-AP, HNRNPU Polyclonal antibody

Size: 20ul / 150ul The HNRNPU (16365-1-AP) by Proteintech is a Polyclonal antibody targeting HNRNPU in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 16365-1-AP targets HNRNPU in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information HNRNPU, also named as HNRPU, SAFA, and U21.1, is a 825 amino acid protein, which is extensively phosphorylated. HNRNPU as a component of ribonucleosomes localized in cytoplasmic mRNP granules containing untranslated mRNAs. HNRNPU is a component of the CRD-mediated complex that promotes MYC mRNA stabilization. HNRNPU Plays a role in the circadian regulation of the core clock component ARNTL/BMAL1 transcription. The calculated molecular weight of HNRNPU is 90 kDa, but the 120 kDa HNRNPU protein is an abundant nucleoplasmic phosphoprotein that can be crosslinked to pre-mRNA in intact cells by UV light (PMID: 1628625). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9151 Product name: Recombinant human HNRNPU protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 462-806 aa of BC003367 Sequence: LEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY Predict reactive species Full Name: heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) Calculated Molecular Weight: 91 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC003367 Gene Symbol: HNRNPU Gene ID (NCBI): 3192 RRID: AB_10596481 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q00839 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.