Proteintech, 16369-1-AP, PIGO Polyclonal antibody

Size: 20ul / 150ul The PIGO (16369-1-AP) by Proteintech is a Polyclonal antibody targeting PIGO in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16369-1-AP targets PIGO in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A431 cells, COLO 320 cells, mouse spleen tissue Positive IHC detected in: human liver tissue, human kidney tissue, human skin tissue, human spleen tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9232 Product name: Recombinant human PIGO protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 867-1089 aa of BC013987 Sequence: FLLLHLLAAGIPVTTPGPFTVPWQAVSAWALMATQTFYSTGHQPVFPAIHWHAAFVGFPEGHGSCTWLPALLVGANTFASHLLFAVGCPLLLLWPFLCESQGLRKRQQPPGNEADARVRPEEEEEPLMEMRLRDAPQHFYAALLQLGLKYLFILGIQILACALAASILRRHLMVWKVFAPKFIFEAVGFIVSSVGLLLGIALVMRVDGAVSSWFRQLFLAQQR Predict reactive species Full Name: phosphatidylinositol glycan anchor biosynthesis, class O Calculated Molecular Weight: 1089aa,119 kDa; 454aa,50 kDa Observed Molecular Weight: 74 kDa GenBank Accession Number: BC013987 Gene Symbol: PIGO Gene ID (NCBI): 84720 RRID: AB_2164806 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TEQ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.