Proteintech, 16376-1-AP, GMPS Polyclonal antibody

Size: 20ul / 150ul The GMPS (16376-1-AP) by Proteintech is a Polyclonal antibody targeting GMPS in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 16376-1-AP targets GMPS in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HL-60 cells, Jurkat cells, mouse brain tissue, mouse testis tissue Positive IP detected in: HeLa cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9350 Product name: Recombinant human GMPS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 345-693 aa of BC012178 Sequence: VKIANEVIGEMNLKPEEVFLAQGTLRPDLIESASLVASGKAELIKTHHNDTELIRKLREEGKVIEPLKDFHKDEVRILGRELGLPEELVSRHPFPGPGLAIRVICAEEPYICKDFPETNNILKIVADFSASVKKPHTLLQRVKACTTEEDQEKLMQITSLHSLNAFLLPIKTVGVQGDCRSYSYVCGISSKDEPDWESLIFLARLIPRMCHNVNRVVYIFGPPVKEPPTDVTPTFLTTGVLSTLRQADFEAHNILRESGYAGKISQMPVILTPLHFDRDPLQKQPSCQRSVVIRTFITSDFMTGIPATPGNEIPVEVVLKMVTEIKKIPGISRIMYDLTSKPPGTTEWE Predict reactive species Full Name: guanine monphosphate synthetase Calculated Molecular Weight: 693 aa, 77 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC012178 Gene Symbol: GMPS Gene ID (NCBI): 8833 RRID: AB_2232412 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49915 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.