Proteintech, 16398-1-AP, Gamma Synuclein/SNCG Polyclonal antibody

Size: 20ul / 150ul The Gamma Synuclein/SNCG (16398-1-AP) by Proteintech is a Polyclonal antibody targeting Gamma Synuclein/SNCG in WB, IHC, ELISA applications with reactivity to human, mouse samples 16398-1-AP targets Gamma Synuclein/SNCG in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HT-29 cells, HeLa cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Gamma synuclein, also known as SNCG, BCSG1, belongs to the synuclein family. SNCG is a synuclein protein found primarily in the peripheral nervous system and retina(PMID 11806835). SNCG is the least conserved of the synuclein proteins and is detected in the brain, ovarian tumors, and the olfactory epithelium(PMID 9750188). SNCG is expressed in high abundance in breast cancer but scarcely at all in a normal breast and is considered a breast cancer marker(PMID: 10813729). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9493 Product name: Recombinant human SNCG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-127 aa of BC014098 Sequence: MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD Predict reactive species Full Name: synuclein, gamma (breast cancer-specific protein 1) Calculated Molecular Weight: 127 aa, 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC014098 Gene Symbol: SNCG Gene ID (NCBI): 6623 RRID: AB_3085489 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O76070 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.