Proteintech, 16406-1-AP, YIF1B Polyclonal antibody

Size: 20ul / 150ul The YIF1B (16406-1-AP) by Proteintech is a Polyclonal antibody targeting YIF1B in WB, ELISA applications with reactivity to human, mouse, rat samples 16406-1-AP targets YIF1B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SK-N-SH cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information YIF1B is an intracellular membrane-bound protein belonging to the Yip family, a trafficking protein orthologue of YIF1P that was initially identified in Saccharomyces cerevisiae as interacting with YIP1P and essential for secretion. YIF1B is expressed in various tissues, especially in brain neurons (PMID: 33103737). YIF1B is localized in the intermediate compartment between the endoplasmic reticulum (ER) and the Golgi apparatus (PMID: 26077767). Western blot analysis detected YIF1B at an apparent molecular mass of 31 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9538 Product name: Recombinant human YIF1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-156 aa of BC014974 Sequence: MHPAGLAAAAAGTPRLPSKRRIPVSQPGMADPHQLFDDTSSAQSRGYGAQRAPGGLSYPAASPTPHAAFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITKLKYYFAVDTMYVGRKLGLLFFPYLHQDWEVQYQQDTPVAPRFDVNAPDLYI Predict reactive species Full Name: Yip1 interacting factor homolog B (S. cerevisiae) Calculated Molecular Weight: 294 aa, 32 kDa Observed Molecular Weight: 31~34 kDa GenBank Accession Number: BC014974 Gene Symbol: YIF1B Gene ID (NCBI): 90522 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5BJH7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.