Iright
BRAND / VENDOR: Proteintech

Proteintech, 16409-1-AP, Biglycan Polyclonal antibody

CATALOG NUMBER: 16409-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Biglycan (16409-1-AP) by Proteintech is a Polyclonal antibody targeting Biglycan in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 16409-1-AP targets Biglycan in WB, IHC, IF/ICC, ELISA, Cell treatment applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: COLO 320 cells, HeLa cells, HepG2 cells, mouse skeletal muscle tissue, pig cartilage tissue Positive IHC detected in: human lung cancer tissue, human colon cancer tissue, human kidney tissue, human liver tissue, human liver cancer tissue, human lung tissue, human renal cell carcinoma tissue, human stomach cancer tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:200-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Biglycan is a member of the small leucine-rich proteoglycan (SLRP) family (PMID: 18463092). It consists of a core protein of 42 kDa containing leucine-rich repeats (LRRs), to which two chondroitin/dermatan sulfate side chains are covalently bound (PMID: 2212616; 10383378). The tissue-specific chondroitin- or dermatan-sulfate glycosaminoglycan chains of biglycan are attached to amino acid residues at the N-terminus of the core protein (PMID: 22821552). Biglycan is a ubiquitous component of connective tissue matrix and may act as a signaling molecule (PMID: 22821552). Upregulation of biglycan has been reported in multiple types of solid cancer (PMID: 32194659). Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0683 Product name: Recombinant human Biglycan protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-368 aa of BC004244 Sequence: MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK Predict reactive species Full Name: biglycan Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 40-48 kDa GenBank Accession Number: BC004244 Gene Symbol: Biglycan Gene ID (NCBI): 633 RRID: AB_10804656 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21810 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924