Proteintech, 16419-1-AP, NLE1 Polyclonal antibody

Size: 20ul / 150ul The NLE1 (16419-1-AP) by Proteintech is a Polyclonal antibody targeting NLE1 in WB, ELISA applications with reactivity to human, mouse, rat samples 16419-1-AP targets NLE1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9604 Product name: Recombinant human NLE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 137-485 aa of BC012075 Sequence: TVRFWDLSTETPHFTCKGHRHWVLSISWSPDGKKLASGCKNGQILLWDPSTGKQVGRTLAGHSKWITGLSWEPLHANPECRYVASSSKDGSVRIWDTTAGRCERILTGHTQSVTCLRWGGDGLLYSASQDRTIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEASVNPQDLQGSLQELKERALSRYNLVRGQGPERLVSGSDDFTLFLWSPAEDKKPLTRMTGHQALINQVLFSPDSRIVASASFDKSIKLWDGRTGKYLASLRGHVAAVYQIAWSADSRLLVSGSSDSTLKVWDVKAQKLAMDLPGHADEVYAVDWSPDGQRVASGGKDKCLRIWRR Predict reactive species Full Name: notchless homolog 1 (Drosophila) Calculated Molecular Weight: 485 aa, 53 kDa Observed Molecular Weight: 45-55 kDa GenBank Accession Number: BC012075 Gene Symbol: NLE1 Gene ID (NCBI): 54475 RRID: AB_2878256 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NVX2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.