Proteintech, 16425-1-AP, RNASE6 Polyclonal antibody

Size: 20ul / 150ul The RNASE6 (16425-1-AP) by Proteintech is a Polyclonal antibody targeting RNASE6 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 16425-1-AP targets RNASE6 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human liver tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: THP-1 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Rnase6, a protein belonging to the superfamily, is considered the only vertebrate specific enzyme known to have a wide range of physiological functions, including digestion, cytotoxicity, angiogenesis, male reproduction, and host defense. Rnase6 expression was upregulated in the peripheral blood and plaque tissues of AS patients (PMID: 34395402). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9667 Product name: Recombinant human RNASE6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-150 aa of BC020848 Sequence: WPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL Predict reactive species Full Name: ribonuclease, RNase A family, k6 Calculated Molecular Weight: 150 aa, 17 kDa GenBank Accession Number: BC020848 Gene Symbol: RNASE6 Gene ID (NCBI): 6039 RRID: AB_3669243 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q93091 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.