Iright
BRAND / VENDOR: Proteintech

Proteintech, 16433-1-AP, STYXL1 Polyclonal antibody

CATALOG NUMBER: 16433-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The STYXL1 (16433-1-AP) by Proteintech is a Polyclonal antibody targeting STYXL1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16433-1-AP targets STYXL1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NCI-H1299 cells, PC-12 cells, mouse testis tissue, rat testis tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information STYXL1, Serine/threonine/tyrosine-interacting-like protein 1, is an inner mitochondrial membrane protein that plays a role in induction of stimulus-dependent apoptosis via the intrinsic apoptotic pathway (PMID: 21262771). STYXL1 catalyzes inactive phosphatase (PMID: 20180778, PMID: 23163895). By binding to G3BP1, STYXL1 inhibits the formation of G3BP1-induced stress granules (PMID: 20180778, PMID: 23163895). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9743 Product name: Recombinant human STYXL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-313 aa of BC024035 Sequence: MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY Predict reactive species Full Name: serine/threonine/tyrosine interacting-like 1 Calculated Molecular Weight: 313 aa, 36 kDa Observed Molecular Weight: 25-36 kDa GenBank Accession Number: BC024035 Gene Symbol: STYXL1 Gene ID (NCBI): 51657 RRID: AB_3085490 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6J8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924