Proteintech, 16447-1-AP, Caveolin-1 Polyclonal antibody

Size: 20ul / 150ul The Caveolin-1 (16447-1-AP) by Proteintech is a Polyclonal antibody targeting Caveolin-1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 16447-1-AP targets Caveolin-1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, NIH/3T3 cells Positive IP detected in: A549 cells Positive IHC detected in: human breast cancer tissue, human lung tissue, human heart tissue, human liver tissue, human lung cancer tissue, mouse brain tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Caveolin-1 (CAV1), a multifunctional protein, is the main constituent molecule of caveolae and represents a scaffolding molecule for several signaling molecules including epidermal growth factor receptor (PMID: 19641024). Several studies have implicated that a reduced expression of CAV1 was found in cancers including head and neck carcinoma (PMID: 19002186). However, other studies recognize CAV1 as a tumor promoter because CAV1 is overexpressed in various kinds of cancers, especially in oral cancer (PMID: 20558341). Recent study also show that CAV1 is involved in astric Cancer (PMID: 25339030). MW of Caveolin-1 is from 20-25 kDa due to phosphorylation (PMID: 10198051). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, canine, monkey, zebrafish, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8049 Product name: Recombinant human Caveolin-1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 11-179 aa of BC006432 Sequence: GHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI Predict reactive species Full Name: caveolin 1, caveolae protein, 22kDa Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 20-25 kDa GenBank Accession Number: BC006432 Gene Symbol: CAV1 Gene ID (NCBI): 857 RRID: AB_10732595 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q03135 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.