Iright
BRAND / VENDOR: Proteintech

Proteintech, 16457-1-AP, MRPS35 Polyclonal antibody

CATALOG NUMBER: 16457-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MRPS35 (16457-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS35 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 16457-1-AP targets MRPS35 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human heart tissue, HepG2 cells Positive IP detected in: HeLa cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Mammalian mitochondrial ribosomes (mitoribosomes) are responsible for protein synthesis within the mitochondrion. The mitoribosomes are composed of a 4:1 ratio of protein to RNA, with the proteins forming two subunits, the 28S subunit and the 39S subunit. Across species, the proteins that make up the mitoribosome subunits vary greatly in sequence, preventing easy recognition by sequence homology. MRPS35 (mitochondrial ribosomal protein S35), also known as MDS023, MRPS28 or HDCMD11P, is a 323 amino acid protein that localizes to the mitochondrion, where it exists as a component of the 28S ribosomal subunit and works in conjunction with other MRPs to mediate protein synthesis. Existing as two alternatively spliced isoforms, MRPS35 is encoded by a gene located on human chromosome 10, which houses over 1,200 genes and comprises nearly 4.5% of the human genome. This antibody is a rabbit polyclonal antibody raised against the full length MRPS35 protein. It specifically reacts with the 37kd MRPS35protein. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9430 Product name: Recombinant human MRPS35 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-323 aa of BC015862 Sequence: MAAAALPAWLSLQSRARTLRAFSTAVYSATPVPTPSLPERTPGNERPPRRKALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT Predict reactive species Full Name: mitochondrial ribosomal protein S35 Calculated Molecular Weight: 323 aa, 37 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC015862 Gene Symbol: MRPS35 Gene ID (NCBI): 60488 RRID: AB_2146521 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P82673 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924