Iright
BRAND / VENDOR: Proteintech

Proteintech, 16477-1-AP, NECAB1 Polyclonal antibody

CATALOG NUMBER: 16477-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NECAB1 (16477-1-AP) by Proteintech is a Polyclonal antibody targeting NECAB1 in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 16477-1-AP targets NECAB1 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information NECAB1, also named as EFCBP1, is a brain-specifically expressed gene with highest abundance in temporal lobe, encodes a protein containing EF-hand and antibiotic biosynthesis monooxygenase domains Short Communication. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9591 Product name: Recombinant human NECAB1 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 252-351 aa of BC016340 Sequence: MLVQRQMSVMEEDLEEFQLALKHYVESASSQSGCLRISIQKLSNESRYMIYEFWENSSVWNSHLQTNYSKTFQRSNVDFLETPELTSTMLVPASWWILNN Predict reactive species Full Name: N-terminal EF-hand calcium binding protein 1 Calculated Molecular Weight: 351 aa, 40 kDa GenBank Accession Number: BC016340 Gene Symbol: NECAB1 Gene ID (NCBI): 64168 RRID: AB_3085492 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N987 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924