Proteintech, 16503-1-AP, WDR48 Polyclonal antibody

Size: 20ul / 150ul The WDR48 (16503-1-AP) by Proteintech is a Polyclonal antibody targeting WDR48 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 16503-1-AP targets WDR48 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells, mouse heart tissue Positive IP detected in: HEK-293 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9674 Product name: Recombinant human WDR48 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 158-502 aa of BC037168 Sequence: RASGDYDNDCTNPITPLCTQPDQVIKGGASIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGFSSPDGSDPKLNLGGLLLQALLEYWPRTHVNPMDEEENEVNHVNGEQENRVQKGNGYFQVPPHTPVIFGEAGGRTLFRLLCRDSGGETESMLLNETVPQWVIDITVDKNMPKFNKIPFYLQPHASSGAKTLKKDRLSASDMLQVRKVMEHVYEKIINLDNESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDPNMDLRTVKHFIWKSGGDLTLHYRQKST Predict reactive species Full Name: WD repeat domain 48 Calculated Molecular Weight: 502aa,57 kDa; 677aa,76 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC037168 Gene Symbol: WDR48 Gene ID (NCBI): 57599 RRID: AB_2878266 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TAF3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.