Iright
BRAND / VENDOR: Proteintech

Proteintech, 16505-1-AP, FBXL8 Polyclonal antibody

CATALOG NUMBER: 16505-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FBXL8 (16505-1-AP) by Proteintech is a Polyclonal antibody targeting FBXL8 in IHC, IP, ELISA applications with reactivity to human, mouse samples 16505-1-AP targets FBXL8 in IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: HCT 116 cells Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FBXL8 is a conserved F-box protein that belongs to the ubiquitin ligase complex. It plays a significant role in various cellular processes, including tumorigenesis and metastasis. In colorectal cancer, FBXL8 promotes liver metastasis and stem-cell-like features by mediating ubiquitination and degradation of TP53. Additionally, FBXL8 has been shown to inhibit lymphoma growth and hematopoietic malignancies by targeting specific substrates for degradation. In the context of cardiac fibrosis, FBXL8 inhibits post-myocardial infarction cardiac fibrosis by regulating the ubiquitination of key proteins (PMID: 36855778, PMID: 33122824, PMID: 38615011). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9685 Product name: Recombinant human FBXL8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-374 aa of BC014414 Sequence: MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCGAASQLRHLDLRRLSFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGPGSVLELLEACPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYAATLCALEVRAAASAELNAALEELAARCAALREVHCFCVVSHSVLDAFRAHCPRLRTYTLKLTREPHPWRPTLVA Predict reactive species Full Name: F-box and leucine-rich repeat protein 8 Calculated Molecular Weight: 374 aa, 41 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC014414 Gene Symbol: FBXL8 Gene ID (NCBI): 55336 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96CD0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924