Proteintech, 16562-1-AP, AGPAT4 Polyclonal antibody

Size: 20ul / 150ul The AGPAT4 (16562-1-AP) by Proteintech is a Polyclonal antibody targeting AGPAT4 in WB, IHC, ELISA applications with reactivity to human samples 16562-1-AP targets AGPAT4 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, U-251 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information AGPAT4 (Acylglycerophosphate acyltransferase 4), also known as LPAATδ (Lysophosphatidic acid acyltransferase delta), is a protein expressed mainly in brain and in muscle. AGPAT4 is characterized as a mitochondrial lysophosphatidic acid acyltransferase that regulates brain levels of phosphatidylcholine (PC), phosphatidylethanolamine (PE), and phosphatidylinositol (PI) (PMID: 28807933). AGPAT4 is relatively abundant in murine renal white adipose tissue (WAT) and has been linked to the regulation of TAG production, the differentiation of adipocytes, and the modulation of various pathologies including lipodystrophy, diabetes, and hepatic steatosis (PMID: 28814640). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9834 Product name: Recombinant human AGPAT4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-300 aa of BC020209 Sequence: SGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMV Predict reactive species Full Name: 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) Calculated Molecular Weight: 378 aa, 44 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC020209 Gene Symbol: AGPAT4 Gene ID (NCBI): 56895 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRZ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.